ggKbase home page

Montesol18-Sp2_coassembly_scaffold_694445_1

Organism: Montesol18_Sp2_coassembly_Alphaproteobacteria_66_15

near complete RP 39 / 55 MC: 2 BSCG 47 / 51 MC: 1 ASCG 11 / 38
Location: comp(3..329)

Top 3 Functional Annotations

Value Algorithm Source
ABC-type branched-chain amino acid transport system, permease component n=1 Tax=Azospira oryzae (strain ATCC BAA-33 / DSM 13638 / PS) RepID=G8QK80_AZOSU similarity UNIREF
DB: UNIREF100
  • Identity: 69.5
  • Coverage: 105.0
  • Bit_score: 149
  • Evalue 1.10e-33
Branched-chain amino acid transport protein (ABC superfamily, membrane) {ECO:0000313|EMBL:CDI03572.1}; TaxID=1400863 species="Bacteria; Proteobacteria; Gammaproteobacteria; Competibacteraceae; Candidatus Competibacter.;" source="Candidatus Competibacter denitrificans Run_A_D11.;" similarity UNIPROT
DB: UniProtKB
  • Identity: 63.6
  • Coverage: 110.0
  • Bit_score: 152
  • Evalue 2.30e-34
branched-chain amino acid ABC transporter permease similarity KEGG
DB: KEGG
  • Identity: 69.5
  • Coverage: 105.0
  • Bit_score: 149
  • Evalue 3.10e-34

Lists

This feature is not on any list.

Notes

This feature has no notes.

Taxonomy

Candidatus Competibacter denitrificans → Candidatus Competibacter → Gammaproteobacteria → Proteobacteria → Bacteria

Sequences

DNA sequence
Length: 327
ATGATTTACCGCGAAGCCGGCCAGTTCAAGACCGCCTACCGCGCCGACCAGGCGATCTTTCCGATCGCCCAGGACCGCATCGGCATCGTGGGGATTATGCTGCTCGCCTTCGTCGTCGTGCCGCTGGTCGCCGACGAATACTGGCTGCGCTCGATCATGGTCCCCTTCCTCGTCTATTCGCTGGCGGCGCTGGGGCTCAATATCCTCACCGGCTATGCCGGCCAGCTGTCGCTTGGCTCGGCCGCGTTCATGTCGATCGGGGCCTTCGCCGCCTATAATTTCGCCATCCGACTCAATCTACCGTTCTATCTCTATCTGCCGGCGGCC
PROTEIN sequence
Length: 109
MIYREAGQFKTAYRADQAIFPIAQDRIGIVGIMLLAFVVVPLVADEYWLRSIMVPFLVYSLAALGLNILTGYAGQLSLGSAAFMSIGAFAAYNFAIRLNLPFYLYLPAA