ggKbase home page

Montesol18-Sp2_coassembly_scaffold_807430_12

Organism: Montesol18_Sp2_coassembly_Alphaproteobacteria_66_15

near complete RP 39 / 55 MC: 2 BSCG 47 / 51 MC: 1 ASCG 11 / 38
Location: 12349..12501

Top 3 Functional Annotations

Value Algorithm Source
Uncharacterized protein n=1 Tax=Azospirillum brasilense Sp245 RepID=G8AMI2_AZOBR similarity UNIREF
DB: UNIREF100
  • Identity: 81.6
  • Coverage: 49.0
  • Bit_score: 87
  • Evalue 3.00e-15
conserved protein of unknown function [Nicotinate/Quinolinate PRTase C-terminal domain-like] similarity KEGG
DB: KEGG
  • Identity: 81.6
  • Coverage: 49.0
  • Bit_score: 87
  • Evalue 8.60e-16
Nicotinate phosphoribosyltransferase {ECO:0000313|EMBL:AIB11498.1}; TaxID=192 species="Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales; Rhodospirillaceae; Azospirillum.;" source="Azospirillum brasilense.;" similarity UNIPROT
DB: UniProtKB
  • Identity: 81.6
  • Coverage: 49.0
  • Bit_score: 87
  • Evalue 4.20e-15

Lists

This feature is not on any list.

Notes

This feature has no notes.

Taxonomy

Azospirillum brasilense → Azospirillum → Rhodospirillales → Alphaproteobacteria → Proteobacteria → Bacteria

Sequences

DNA sequence
Length: 153
ATGGCGGTCGCCAACGTGCCGGTGGACGTGATCGGCACCGGCTCCTATCTGCCCGAAACCTGGACCGAAACCTACGCCACCGCCGATATCGTCGAATACGACGGCAAGCCGTCGGTCAAGGTCGGCCGCGAGTTCCTGCTGCGAAAGAAATAG
PROTEIN sequence
Length: 51
MAVANVPVDVIGTGSYLPETWTETYATADIVEYDGKPSVKVGREFLLRKK*