ggKbase home page

PLM1_100_b1_sep16_scaffold_20405_1

Organism: PLM1_100_b1_sep16_Actinobacteria_69_15

near complete RP 47 / 55 MC: 3 BSCG 49 / 51 MC: 2 ASCG 12 / 38
Location: comp(2..184)

Top 3 Functional Annotations

Value Algorithm Source
Dihydropyrimidinase Tax=Sphaerobacter thermophilus (strain DSM 20745 / S 6022) RepID=D1C943_SPHTD similarity UNIREF
DB: UNIREF100
  • Identity: 77.0
  • Coverage: 61.0
  • Bit_score: 104
  • Evalue 3.80e-20
dihydropyrimidinase similarity KEGG
DB: KEGG
  • Identity: 77.0
  • Coverage: 61.0
  • Bit_score: 104
  • Evalue 1.10e-20
Dihydropyrimidinase {ECO:0000313|EMBL:ACZ40336.1}; species="Bacteria; Chloroflexi; Sphaerobacteridae; Sphaerobacterales; Sphaerobacterineae; Sphaerobacteraceae; Sphaerobacter.;" source="Sphaerobacter thermophilus (strain DSM 20745 / S 6022).;" similarity UNIPROT
DB: UniProtKB
  • Identity: 77.0
  • Coverage: 61.0
  • Bit_score: 104
  • Evalue 5.30e-20

Lists

This feature is not on any list.

Notes

This feature has no notes.

Taxonomy

Sphaerobacter thermophilus → Sphaerobacter → Sphaerobacterales → Sphaerobacteridae → Chloroflexi → Bacteria

Sequences

DNA sequence
Length: 183
ATGTCGGTTCTCATCAGGGGCGGCCGCATCATCACGGCCGCCGACGACTACGTTGCCGACATCTACGTCGAGGACGAGGCGGTCTCGCTGATCGGCGAGTCGCTCGACGTCCAGGCGGACCGGATCATCGACGCCTCCGGGAAGTACGTGCTTCCCGGGGGCGTCGACCCCCATACGCACCTC
PROTEIN sequence
Length: 61
MSVLIRGGRIITAADDYVADIYVEDEAVSLIGESLDVQADRIIDASGKYVLPGGVDPHTHL