ggKbase home page
This organism can only be binned in the context of its binning project RIFCSPLOWO2_12_FULL. Please contact the project owner (jbanfield@berkeley.edu) to become a member and gain access.

AMDSBA5_37_1

Organism: S._thermosulfido._IM5

near complete RP 51 / 55 MC: 14 BSCG 51 / 51 MC: 1 ASCG 0 / 38
Location: comp(1..369)

Top 3 Functional Annotations

Value Algorithm Source
(db=HMMPfam db_id=PF04309 from=11 to=110 evalue=1.1e-24 interpro_id=IPR006699 interpro_description=Glycerol-3-phosphate responsive antiterminator GO=Biological Process: regulation of transcription, DNA-dependent (GO:0006355), Biological Process: response to biotic stimulus (GO:0009607)) iprscan interpro
DB: HMMPfam
  • Identity: null
  • Coverage: null
  • Bit_score: null
  • Evalue 1.10e-24
GlpP-like (db=superfamily db_id=SSF110391 from=10 to=110 evalue=6.8e-24 interpro_id=IPR006699 interpro_description=Glycerol-3-phosphate responsive antiterminator GO=Biological Process: regulation of transcription, DNA-dependent (GO:0006355), Biological Process: response to biotic stimulus (GO:0009607)) iprscan interpro
DB: superfamily
  • Identity: null
  • Coverage: null
  • Bit_score: null
  • Evalue 6.80e-24
no description (db=Gene3D db_id=G3DSA:3.20.20.400 from=11 to=110 evalue=3.2e-19 interpro_id=IPR006699 interpro_description=Glycerol-3-phosphate responsive antiterminator GO=Biological Process: regulation of transcription, DNA-dependent (GO:0006355), Biological Process: response to biotic stimulus (GO:0009607)) iprscan interpro
DB: Gene3D
  • Identity: null
  • Coverage: null
  • Bit_score: null
  • Evalue 3.20e-19

Lists

This feature is not on any list.

Notes

This feature has no notes.

Taxonomy

Sulfobacillus acidophilus → Sulfobacillus → Clostridiales → Clostridia → Firmicutes → Bacteria

Sequences

DNA sequence
Length: 369
ATGCGACTTCATAAATCAACGATGCCTATCGTTATTCCGGCACTTCGCGATCCTGAACACTGGCGATTATTAGGAGAGGGAGAAGGAGCATGGGTCTTTTTGTTGGGAGGTAGTGTGGACAGTGTTGCCGAAGGCGTAGCACGGTTACAAAAACGTCATTGGCGTGTTTTTGTTCACGTAGACATGGTTAAAGGTATTGCTAACGATTCCGAAGGTCTACGATTTTTTCATGATTATGCTGCTCCCGATGGCATTATTTCGACGCATAGTCATACAGTGAGCAACGCGGTGAAGTTGGGTATGCTTGCCATTCAACGTATTTTTTTAATTGGAGCTTTTTGCGCTGTAGTCGATCTCCGTGAGTTGGCG
PROTEIN sequence
Length: 123
MRLHKSTMPIVIPALRDPEHWRLLGEGEGAWVFLLGGSVDSVAEGVARLQKRHWRVFVHVDMVKGIANDSEGLRFFHDYAAPDGIISTHSHTVSNAVKLGMLAIQRIFLIGAFCAVVDLRELA