ggKbase home page

ERMLT700_curated_scaffold_235_6

Organism: ERMLT700_Acidobacteria_63_19_curated

near complete RP 49 / 55 MC: 1 BSCG 49 / 51 MC: 3 ASCG 12 / 38
Location: comp(7162..7416)

Top 3 Functional Annotations

Value Algorithm Source
Fis family transcriptional regulator id=12556814 bin=CNBR_ACIDO species=Brevibacillus borstelensis genus=Brevibacillus taxon_order=Bacillales taxon_class=Bacilli phylum=Firmicutes tax=CNBR_ACIDO organism_group=Acidobacteria organism_desc=why is coverage listed as 1? similarity UNIREF
DB: UNIREF100
  • Identity: 50.0
  • Coverage: 78.0
  • Bit_score: 73
  • Evalue 7.60e-11
Two component, sigma54 specific, transcriptional regulator, Fis family {ECO:0000313|EMBL:EHO42494.1}; TaxID=880073 species="Bacteria; Caldithrix.;" source="Caldithrix abyssi DSM 13497.;" similarity UNIPROT
DB: UniProtKB
  • Identity: 45.1
  • Coverage: 82.0
  • Bit_score: 63
  • Evalue 1.10e-07
Fis family two component sigma-54 specific transcriptional regulator similarity KEGG
DB: KEGG
  • Identity: 34.8
  • Coverage: 89.0
  • Bit_score: 54
  • Evalue 1.30e-05

Lists

This feature is not on any list.

Notes

This feature has no notes.

Taxonomy

Caldithrix abyssi → Caldithrix → Bacteria

Sequences

DNA sequence
Length: 255
ATGGTCTTGGAACGGGCAGCGATCCTCTGTGAAGGCGGGCCGATCGACGTGAGCCATTTGCGCCTGCAATCAGGCGCGAAGTCACTCCGCGACGACACCACCGATCTGAGCGTCGTCGAACGCACAACGATTGCGAAGGTCTTGAACGATTGCCGCGGAAACAAAACGAAGGCCGCGCGGAGACTTGGGTTGTCACGCACGCAGCTTCATATGCGGATTCGAAAGTACCGACTCGAGGAAGCAGCCACGGCGTGA
PROTEIN sequence
Length: 85
MVLERAAILCEGGPIDVSHLRLQSGAKSLRDDTTDLSVVERTTIAKVLNDCRGNKTKAARRLGLSRTQLHMRIRKYRLEEAATA*