ggKbase home page

Montesol18-Sp2_coassembly_scaffold_327752_4

Organism: Montesol18_Sp2_coassembly_Alphaproteobacteria_66_15

near complete RP 39 / 55 MC: 2 BSCG 47 / 51 MC: 1 ASCG 11 / 38
Location: 2632..2856

Top 3 Functional Annotations

Value Algorithm Source
Osmotically-inducible lipoprotein B n=1 Tax=Azospirillum brasilense Sp245 RepID=G8AEE1_AZOBR similarity UNIREF
DB: UNIREF100
  • Identity: 51.4
  • Coverage: 70.0
  • Bit_score: 71
  • Evalue 2.50e-10
osmB; osmotically-inducible lipoprotein B similarity KEGG
DB: KEGG
  • Identity: 51.4
  • Coverage: 70.0
  • Bit_score: 71
  • Evalue 7.20e-11
Lipoprotein {ECO:0000313|EMBL:AIB12884.1}; TaxID=192 species="Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales; Rhodospirillaceae; Azospirillum.;" source="Azospirillum brasilense.;" similarity UNIPROT
DB: UniProtKB
  • Identity: 51.4
  • Coverage: 70.0
  • Bit_score: 71
  • Evalue 3.60e-10

Lists

This feature is not on any list.

Notes

This feature has no notes.

Taxonomy

Azospirillum brasilense → Azospirillum → Rhodospirillales → Alphaproteobacteria → Proteobacteria → Bacteria

Sequences

DNA sequence
Length: 225
ATGACCAAGAAATTCCTGGTGACGATAGCGGCGCTGACCCTCAGCCTGTCGGCCTGCTCGGGCATGACGGAGCGCGAACAGCGGACCGTAACCGGCGGTGCGATCGGCGTCGCGGGCGGTGCCGCGATCGGCCTGATCGGCGGCTTCAACCCGTGGGCCGGCGCCCTGATCGGCGGCGCGACCGGCACCGCCATCGGCGCGCTCACCGATATCGGCAAGCGCTGA
PROTEIN sequence
Length: 75
MTKKFLVTIAALTLSLSACSGMTEREQRTVTGGAIGVAGGAAIGLIGGFNPWAGALIGGATGTAIGALTDIGKR*