ggKbase home page
This organism can only be binned in the context of its binning project RAAC. Please contact the project owner (jbanfield@berkeley.edu) to become a member and gain access.

ACD20_34_30

Organism: ACD20

near complete RP 51 / 55 MC: 13 BSCG 50 / 51 MC: 4 ASCG 0 / 38
Location: comp(33243..33449)

Top 3 Functional Annotations

Value Algorithm Source
4FE4S_FER_1 (db=PatternScan db_id=PS00198 from=10 to=21 evalue=0.0 interpro_id=IPR017900 interpro_description=4Fe-4S ferredoxin, iron-sulphur binding, conserved site GO=Molecular Function: electron carrier activity (GO:0009055), Molecular Function: iron-sulfur cluster binding (GO:0051536)) iprscan interpro
DB: PatternScan
  • Identity: null
  • Coverage: null
  • Bit_score: null
  • Evalue 0.0
4FE4S_FER_1 (db=PatternScan db_id=PS00198 from=39 to=50 evalue=0.0 interpro_id=IPR017900 interpro_description=4Fe-4S ferredoxin, iron-sulphur binding, conserved site GO=Molecular Function: electron carrier activity (GO:0009055), Molecular Function: iron-sulfur cluster binding (GO:0051536)) iprscan interpro
DB: PatternScan
  • Identity: null
  • Coverage: null
  • Bit_score: null
  • Evalue 0.0
4Fe-4S ferredoxins (db=superfamily db_id=SSF54862 from=2 to=59 evalue=6.5e-16) iprscan interpro
DB: superfamily
  • Identity: null
  • Coverage: null
  • Bit_score: null
  • Evalue 6.50e-16

Lists

This feature is not on any list.

Notes

This feature has no notes.

Taxonomy

uncultured bacterium → Bacteria

Sequences

DNA sequence
Length: 207
ATGCCAAGACAAATCAATATAGAAAATTGTACACAATGTGGGGCATGCCTTCCAGCTTGCCCTGTAGATGCAATAGAAACCAGAGATGGAATTATTCAGATTAATCCTGATGAATGTGTAGATTGCCAAACATGCTGGCGAATTTGCCCGGAAAAGTGCATAGACGGCGGCCCGGATAAATACCTCGAATTAAGGACTGAACAGTAG
PROTEIN sequence
Length: 69
MPRQINIENCTQCGACLPACPVDAIETRDGIIQINPDECVDCQTCWRICPEKCIDGGPDKYLELRTEQ*