ggKbase home page
You are taken to the binning project of this organism.

ACD12_132_3

Organism: ACD12

megabin RP 52 / 55 MC: 37 BSCG 46 / 51 MC: 26 ASCG 0 / 38
Location: 705..989

Top 3 Functional Annotations

Value Algorithm Source
OSCP (db=HMMPfam db_id=PF00213 from=18 to=90 evalue=1.3e-13 interpro_id=IPR000711 interpro_description=ATPase, F1 complex, OSCP/delta subunit GO=Cellular Component: plasma membrane (GO:0005886), Biological Process: ATP synthesis coupled proton transport (GO:0015986), Cellular Component: proton-transporting ATP synthase complex, catalytic core F(1) (GO:0045261), Molecular Function: hydrogen ion transporting ATP synthase activity, rotational mechanism (GO:0046933)) iprscan interpro
DB: HMMPfam
  • Identity: null
  • Coverage: null
  • Bit_score: null
  • Evalue 1.30e-13
ATP SYNTHASE DELTA CHAIN (db=HMMPanther db_id=PTHR11910 from=14 to=94 evalue=1.1e-06 interpro_id=IPR000711 interpro_description=ATPase, F1 complex, OSCP/delta subunit GO=Cellular Component: plasma membrane (GO:0005886), Biological Process: ATP synthesis coupled proton transport (GO:0015986), Cellular Component: proton-transporting ATP synthase complex, catalytic core F(1) (GO:0045261), Molecular Function: hydrogen ion transporting ATP synthase activity, rotational mechanism (GO:0046933)) iprscan interpro
DB: HMMPanther
  • Identity: null
  • Coverage: null
  • Bit_score: null
  • Evalue 1.10e-06
ATPASEDELTA (db=FPrintScan db_id=PR00125 from=50 to=65 evalue=5.2e-06 interpro_id=IPR000711 interpro_description=ATPase, F1 complex, OSCP/delta subunit GO=Cellular Component: plasma membrane (GO:0005886), Biological Process: ATP synthesis coupled proton transport (GO:0015986), Cellular Component: proton-transporting ATP synthase complex, catalytic core F(1) (GO:0045261), Molecular Function: hydrogen ion transporting ATP synthase activity, rotational mechanism (GO:0046933)) iprscan interpro
DB: FPrintScan
  • Identity: null
  • Coverage: null
  • Bit_score: null
  • Evalue 5.20e-06

Lists

This feature is not on any list.

Notes

This feature has no notes.

Taxonomy

uncultured bacterium → Bacteria

Sequences

DNA sequence
Length: 285
ATGAAAATTAATCCAAAACTAAAGAAGGATCTAAAAAGTTTTTTACTGGAGAATATACAGAAAGAACAGAATCGCGTACTTGTAATGAGCGCCGATGCTCTTGAATCCGATGAAAAAAAAATTTTGAGCAAAAAATTTTCAGACTTAAATTGGAATGAAGCAGATTTTCAAGTCGATAAATCAATAATTGCCGGAATTATTATTAAAGTCGGATCAAAAACAATCGATTTGTCCCTTATGGGATCGTTATCTAAATTATCTAATACATTATATGAAATTGATTGA
PROTEIN sequence
Length: 95
MKINPKLKKDLKSFLLENIQKEQNRVLVMSADALESDEKKILSKKFSDLNWNEADFQVDKSIIAGIIIKVGSKTIDLSLMGSLSKLSNTLYEID*