ggKbase home page

ACD40_25_7

Organism: ACD40

partial RP 43 / 55 MC: 9 BSCG 39 / 51 MC: 3 ASCG 0 / 38
Location: comp(5800..6087)

Top 3 Functional Annotations

Value Algorithm Source
Ribosomal protein S20 (db=superfamily db_id=SSF46992 from=19 to=95 evalue=2.6e-10 interpro_id=IPR002583 interpro_description=Ribosomal protein S20 GO=Molecular Function: RNA binding (GO:0003723), Molecular Function: structural constituent of ribosome (GO:0003735), Cellular Component: intracellular (GO:0005622), Cellular Component: ribosome (GO:0005840), Biological Process: translation (GO:0006412)) iprscan interpro
DB: superfamily
  • Identity: null
  • Coverage: null
  • Bit_score: null
  • Evalue 2.60e-10
Ribosomal_S20p (db=HMMPfam db_id=PF01649 from=20 to=94 evalue=1.4e-08 interpro_id=IPR002583 interpro_description=Ribosomal protein S20 GO=Molecular Function: RNA binding (GO:0003723), Molecular Function: structural constituent of ribosome (GO:0003735), Cellular Component: intracellular (GO:0005622), Cellular Component: ribosome (GO:0005840), Biological Process: translation (GO:0006412)) iprscan interpro
DB: HMMPfam
  • Identity: null
  • Coverage: null
  • Bit_score: null
  • Evalue 1.40e-08
no description (db=Gene3D db_id=G3DSA:1.20.58.110 from=21 to=93 evalue=6.1e-08 interpro_id=IPR002583 interpro_description=Ribosomal protein S20 GO=Molecular Function: RNA binding (GO:0003723), Molecular Function: structural constituent of ribosome (GO:0003735), Cellular Component: intracellular (GO:0005622), Cellular Component: ribosome (GO:0005840), Biological Process: translation (GO:0006412)) iprscan interpro
DB: Gene3D
  • Identity: null
  • Coverage: null
  • Bit_score: null
  • Evalue 6.10e-08

Lists

This feature is not on any list.

Notes

This feature has no notes.

Taxonomy

uncultured bacterium → Bacteria

Sequences

DNA sequence
Length: 288
TTGCATTGGGAGTTGCAGGGCACACCACCTCTAGGGTATAATCCCCTCATGCCAATAACCAAATCAGCGATCAAGAAACAGAGGGTAGATAAAAAACGGACTAAACAAAACCTACCACTACTTGGTCGAGTGAAAACTTCAATTAAAGAAGCGCGCATAAAAGCGACGCCCGACAAGCTGAAGATTGTCTACTCCACCCTGGATAGAGCAGTCAAACATCATTTGGTTCCGAAACGCCGAGCAGCGAGGTTGAAGTCAAGGATCGCCAAAAAGAGCAAAAAGAACTAG
PROTEIN sequence
Length: 96
LHWELQGTPPLGYNPLMPITKSAIKKQRVDKKRTKQNLPLLGRVKTSIKEARIKATPDKLKIVYSTLDRAVKHHLVPKRRAARLKSRIAKKSKKN*