ggKbase home page

ACD41_10_30

Organism: ACD41

megabin RP 44 / 55 MC: 20 BSCG 41 / 51 MC: 16 ASCG 0 / 38
Location: comp(16168..16524)

Top 3 Functional Annotations

Value Algorithm Source
seg (db=Seg db_id=seg from=77 to=92) iprscan interpro
DB: Seg
  • Identity: null
  • Coverage: null
  • Bit_score: null
Ribosomal proteins S24e, L23 and L15e (db=superfamily db_id=SSF54189 from=35 to=118 evalue=1.2e-16 interpro_id=IPR012678 interpro_description=Ribosomal protein L23/L15e, core GO=Molecular Function: structural constituent of ribosome (GO:0003735), Cellular Component: intracellular (GO:0005622), Cellular Component: ribosome (GO:0005840), Biological Process: translation (GO:0006412)) iprscan interpro
DB: superfamily
  • Identity: null
  • Coverage: null
  • Bit_score: null
  • Evalue 1.20e-16
no description (db=Gene3D db_id=G3DSA:3.30.70.330 from=35 to=117 evalue=3.3e-16 interpro_id=IPR012677 interpro_description=Nucleotide-binding, alpha-beta plait GO=Molecular Function: nucleotide binding (GO:0000166)) iprscan interpro
DB: Gene3D
  • Identity: null
  • Coverage: null
  • Bit_score: null
  • Evalue 3.30e-16

Lists

This feature is not on any list.

Notes

This feature has no notes.

Taxonomy

uncultured bacterium → Bacteria

Sequences

DNA sequence
Length: 357
ATGGGATTATTTTCAAAGAAAATAAAGACACCAACTCCCGCTCAACCAGTACGGGAAGTATCTGACGTCAAAAAACCTTCGACCGGTTCTGTAAAATCAGTTGTACTGATCCAGCCTCTGGTGACTGAAAAAGCGACCGCCACCGGTACCTATTTATTTAGAGTGGCACCGTTAGCGACAAAAAGTGAAATTCGCAAAGCCTTCCAAGCCAAGTATGGAAAAACACCGCGCAAGGTGAATGTGGTCAATGTCATGGGGAAAGTGAAGATGCGTGGTCGCGTGGTCGGCAAGCGGTCTAACTGGAAAAAAGCCGTGGTCTATTTAGCCAAAGGCGAAACTGTCGATTTATTTCAATAA
PROTEIN sequence
Length: 119
MGLFSKKIKTPTPAQPVREVSDVKKPSTGSVKSVVLIQPLVTEKATATGTYLFRVAPLATKSEIRKAFQAKYGKTPRKVNVVNVMGKVKMRGRVVGKRSNWKKAVVYLAKGETVDLFQ*