ggKbase home page

ERMLT700_curated_scaffold_2280_1

Organism: ERMLT700_Acidobacteria_63_19_curated

near complete RP 49 / 55 MC: 1 BSCG 49 / 51 MC: 3 ASCG 12 / 38
Location: 1..186

Top 3 Functional Annotations

Value Algorithm Source
Integrase catalytic region n=1 Tax=Methylobacterium sp. (strain 4-46) RepID=B0UJM6_METS4 similarity UNIREF
DB: UNIREF100
  • Identity: 58.6
  • Coverage: 58.0
  • Bit_score: 77
  • Evalue 2.90e-12
integrase catalytic subunit similarity KEGG
DB: KEGG
  • Identity: 58.6
  • Coverage: 58.0
  • Bit_score: 77
  • Evalue 8.30e-13
Integrase catalytic region {ECO:0000313|EMBL:ACA17761.1}; TaxID=426117 species="Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Methylobacteriaceae; Methylobacterium.;" source="Methylobacterium sp. (strain 4-46).;" similarity UNIPROT
DB: UniProtKB
  • Identity: 58.6
  • Coverage: 58.0
  • Bit_score: 77
  • Evalue 4.10e-12

Lists

This feature is not on any list.

Notes

This feature has no notes.

Taxonomy

Methylobacterium sp. 4-46 → Methylobacterium → Rhizobiales → Alphaproteobacteria → Proteobacteria → Bacteria

Sequences

DNA sequence
Length: 186
TATAACTGGGATCGTCCGCATTCATCACTGGCCGGCAAGACGCCAATCGATCGTGTCTGCGAGCTCTCGGAGCAAACGCCGCTTCACGAAGAGGTGGACGCGCTGTACGACCCAGATCAGGAACCCACCCGCCACCCTGAATACGCGGTCGACATCGCTCTCAAAACATTGAAACGATGTCTATGA
PROTEIN sequence
Length: 62
YNWDRPHSSLAGKTPIDRVCELSEQTPLHEEVDALYDPDQEPTRHPEYAVDIALKTLKRCL*