ggKbase home page

ACD50_132_3

Organism: ACD50

near complete RP 51 / 55 MC: 21 BSCG 45 / 51 MC: 9 ASCG 0 / 38
Location: 1065..1568

Top 3 Functional Annotations

Value Algorithm Source
C-terminal effector domain of the bipartite response regulators (db=superfamily db_id=SSF46894 from=52 to=156 evalue=5.2e-09 interpro_id=IPR016032 interpro_description=Signal transduction response regulator, C-terminal effector GO=Molecular Function: two-component response regulator activity (GO:0000156), Biological Process: two-component signal transduction system (phosphorelay) (GO:0000160), Molecular Function: DNA binding (GO:0003677), Cellular Component: intracellular (GO:0005622), Biological Process: r iprscan interpro
DB: superfamily
  • Identity: null
  • Coverage: null
  • Bit_score: null
  • Evalue 5.20e-09
Trans_reg_C (db=HMMPfam db_id=PF00486 from=81 to=156 evalue=1.9e-06 interpro_id=IPR001867 interpro_description=Signal transduction response regulator, C-terminal GO=Molecular Function: two-component response regulator activity (GO:0000156), Biological Process: two-component signal transduction system (phosphorelay) (GO:0000160), Molecular Function: DNA binding (GO:0003677), Biological Process: regulation of transcription, DNA-dependent (GO:0006355)) iprscan interpro
DB: HMMPfam
  • Identity: null
  • Coverage: null
  • Bit_score: null
  • Evalue 1.90e-06
no description (db=Gene3D db_id=G3DSA:1.10.10.10 from=51 to=159 evalue=4.0e-05 interpro_id=IPR011991 interpro_description=Winged helix-turn-helix transcription repressor DNA-binding) iprscan interpro
DB: Gene3D
  • Identity: null
  • Coverage: null
  • Bit_score: null
  • Evalue 4.00e-05

Lists

This feature is not on any list.

Notes

This feature has no notes.

Taxonomy

R_OP11_Woesebacteria_38_26 → Woesebacteria → Microgenomates → Bacteria

Sequences

DNA sequence
Length: 504
ATGGCTTTAGAAAGACTTGCAGAAATAGCAGAAATGGGGGGCGACCCGGATTTGGCTTTTGAATTTAGGGATATGTCCAAGAGACAGAAAGCTAAAGATTATGATGTGTTAGAAGGTGTTACAGTATATGATAAAAGCCTTGAGCTTGCAATTGATGAGGGGCGTATTTATGAGCATCATGGATTGAAGCTTAATTTTCACTCCGGGACAAGGGTTGTAGTGAGAAATGGAATATCTAATAAACTGTATCCCAAAGAGAGCAAATGTCTGGAGCTGTTGTTGGTAAATAAGGGTGCTCCTGTAACATATCCCATGTTTGATCAATTATTATACAACTCAAATATTGATATTGATTTTAGAAATGCATTGACTAACATTATATTTAAAATAAGGATGGTTTTGGAACCAGGGAAAAGCGCCAAGGAGTGTAAATATCTAGTTAATATATCTAATAAAGGATATATCTTAAAAGATATCGATACTGAAGGCAATTCAAGCGCTTAA
PROTEIN sequence
Length: 168
MALERLAEIAEMGGDPDLAFEFRDMSKRQKAKDYDVLEGVTVYDKSLELAIDEGRIYEHHGLKLNFHSGTRVVVRNGISNKLYPKESKCLELLLVNKGAPVTYPMFDQLLYNSNIDIDFRNALTNIIFKIRMVLEPGKSAKECKYLVNISNKGYILKDIDTEGNSSA*