ggKbase home page

ACD69_89_1

Organism: ACD69

near complete RP 42 / 55 MC: 12 BSCG 41 / 51 MC: 5 ASCG 0 / 38
Location: 3..140

Top 3 Functional Annotations

Value Algorithm Source
DALR_1 (db=HMMPfam db_id=PF05746 from=1 to=45 evalue=4.8e-10 interpro_id=IPR008909 interpro_description=DALR anticodon binding GO=Molecular Function: arginine-tRNA ligase activity (GO:0004814), Molecular Function: ATP binding (GO:0005524), Biological Process: arginyl-tRNA aminoacylation (GO:0006420)) iprscan interpro
DB: HMMPfam
  • Identity: null
  • Coverage: null
  • Bit_score: null
  • Evalue 4.80e-10
Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases (db=superfamily db_id=SSF47323 from=1 to=45 evalue=1.7e-07 interpro_id=IPR009080 interpro_description=Aminoacyl-tRNA synthetase, class 1a, anticodon-binding GO=Molecular Function: nucleotide binding (GO:0000166), Molecular Function: aminoacyl-tRNA ligase activity (GO:0004812), Molecular Function: ATP binding (GO:0005524), Cellular Component: cytoplasm (GO:0005737), Biological Process: translation (GO:0006412), Biological Process: t iprscan interpro
DB: superfamily
  • Identity: null
  • Coverage: null
  • Bit_score: null
  • Evalue 1.70e-07
ARGINYL-TRNA SYNTHETASE (db=HMMPanther db_id=PTHR11956 from=1 to=45 evalue=2.7e-06 interpro_id=IPR001278 interpro_description=Arginyl-tRNA synthetase, class Ic GO=Molecular Function: arginine-tRNA ligase activity (GO:0004814), Molecular Function: ATP binding (GO:0005524), Cellular Component: cytoplasm (GO:0005737), Biological Process: arginyl-tRNA aminoacylation (GO:0006420)) iprscan interpro
DB: HMMPanther
  • Identity: null
  • Coverage: null
  • Bit_score: null
  • Evalue 2.70e-06

Lists

This feature is not on any list.

Notes

This feature has no notes.

Taxonomy

uncultured bacterium → Bacteria

Sequences

DNA sequence
Length: 138
TTTTATGAGAATTGTCCAATTATGAAAGCCGCTAATCAAAAGCAACATGATAGTCGTTTAGCTTTTGCAGCGCTGACTTCAGAAATTCTCAAGGTAAGTTTGAATTTGCTTGGGATTGAAGTTGTTGCTCAGATGTAA
PROTEIN sequence
Length: 46
FYENCPIMKAANQKQHDSRLAFAALTSEILKVSLNLLGIEVVAQM*