ggKbase home page

PLM4_65_b1_redo_sep16_scaffold_6795_3

Organism: PLM4_65_b1_sep16_Acidobacteria_68_8

near complete RP 42 / 55 BSCG 44 / 51 ASCG 12 / 38 MC: 1
Location: comp(1383..1547)

Top 3 Functional Annotations

Value Algorithm Source
Putative uncharacterized protein bin=GWF2_Lentisphaerae_57_35 species=Desulfocapsa sulfexigens genus=Desulfocapsa taxon_order=Desulfobacterales taxon_class=Deltaproteobacteria phylum=Proteobacteria tax=GWF2_Lentisphaerae_57_35 organism_group=Lentisphaerae organism_desc=a459 similarity UNIREF
DB: UNIREF100
  • Identity: 55.6
  • Coverage: 54.0
  • Bit_score: 63
  • Evalue 6.60e-08
hypothetical protein similarity KEGG
DB: KEGG
  • Identity: 42.6
  • Coverage: 54.0
  • Bit_score: 52
  • Evalue 3.30e-05
Tax=RifOxyA12_full_Lentisphaerae_48_11_curated similarity UNIPROT
DB: UniProtKB
  • Identity: 55.6
  • Coverage: 54.0
  • Bit_score: 67
  • Evalue 6.40e-09

Lists

This feature is not on any list.

Notes

This feature has no notes.

Taxonomy

RifOxyA12_full_Lentisphaerae_48_11_curated → Lentisphaerae → Bacteria

Sequences

DNA sequence
Length: 165
ATGGGAAGACTCGGGTACGTCACCACCCTGATCCGCGACTTCGTCGGCTTCGCCCGCGAGCACAAAGCGTGGTGGATCGTGCCACTGCTCATCGTCCTCGGCCTCGTCGCCCTCCTCATCGCCACCGGCCAGGCCTCCGCGCCGTTCATCTACACCCTGTTCTGA
PROTEIN sequence
Length: 55
MGRLGYVTTLIRDFVGFAREHKAWWIVPLLIVLGLVALLIATGQASAPFIYTLF*