ggKbase home page

ACD34_219_1

Organism: ACD34

partial RP 40 / 55 MC: 6 BSCG 34 / 51 MC: 3 ASCG 0 / 38
Location: 3..308

Top 3 Functional Annotations

Value Algorithm Source
Sigma70_r4_2 (db=HMMPfam db_id=PF08281 from=2 to=46 evalue=1.2e-10 interpro_id=IPR013249 interpro_description=RNA polymerase sigma factor 70, region 4 type 2 GO=Molecular Function: DNA binding (GO:0003677), Molecular Function: transcription factor activity (GO:0003700), Biological Process: transcription initiation (GO:0006352), Biological Process: regulation of transcription, DNA-dependent (GO:0006355), Molecular Function: sigma factor activity (GO:0016987)) iprscan interpro
DB: HMMPfam
  • Identity: null
  • Coverage: null
  • Bit_score: null
  • Evalue 1.20e-10
Sigma3 and sigma4 domains of RNA polymerase sigma factors (db=superfamily db_id=SSF88659 from=1 to=52 evalue=1.2e-10 interpro_id=IPR013324 interpro_description=RNA polymerase sigma factor, region 3/4 GO=Molecular Function: DNA binding (GO:0003677), Molecular Function: transcription factor activity (GO:0003700), Biological Process: transcription initiation (GO:0006352), Biological Process: regulation of transcription, DNA-dependent (GO:0006355), Molecular Function: sigma factor activity (GO:0016987)) iprscan interpro
DB: superfamily
  • Identity: null
  • Coverage: null
  • Bit_score: null
  • Evalue 1.20e-10
Sigma3 and sigma4 domains of RNA polymerase sigma factors (db=superfamily db_id=SSF88659 from=58 to=95 evalue=1.9e-05 interpro_id=IPR013324 interpro_description=RNA polymerase sigma factor, region 3/4 GO=Molecular Function: DNA binding (GO:0003677), Molecular Function: transcription factor activity (GO:0003700), Biological Process: transcription initiation (GO:0006352), Biological Process: regulation of transcription, DNA-dependent (GO:0006355), Molecular Function: sigma factor activity (GO:0016987)) iprscan interpro
DB: superfamily
  • Identity: null
  • Coverage: null
  • Bit_score: null
  • Evalue 1.90e-05

Lists

This feature is not on any list.

Notes

This feature has no notes.

Taxonomy

CG_Anaero_01 → Anaerolineae → Chloroflexi → Bacteria

Sequences

DNA sequence
Length: 306
TCCAAACTACCTCCGCGTGAAAGAGCCGTGATTGTCGAACGCTATTACCTCGAATTGAGCGAAAAGGAAATGGCCGAGATGCATGATGTCGCTCCCGGGACGGTGAAATGGCTCTTGAACGTGGCGCGGAAAAAGCTGCGCTCGTTCATGGGATNNNNNNNNNNCGTTGAACGCTATTACCTTGACCTGAGCGAAAAGGAAATGGCCGAGATGCATGAGGTTGCTCCCGGGACGGTGAAATGGCTCTTGAATGTGGCGCGGAAAAAGCTGCGCTCGTTCATGGGATTGGAAAGTGACCCATCATGA
PROTEIN sequence
Length: 102
SKLPPRERAVIVERYYLELSEKEMAEMHDVAPGTVKWLLNVARKKLRSFMGXXXXVERYYLDLSEKEMAEMHEVAPGTVKWLLNVARKKLRSFMGLESDPS*