ggKbase home page

ACD15_39_25

Organism: ACD15

near complete RP 50 / 55 MC: 14 BSCG 47 / 51 MC: 5 ASCG 0 / 38
Location: 24183..24470

Top 3 Functional Annotations

Value Algorithm Source
seg (db=Seg db_id=seg from=64 to=95) iprscan interpro
DB: Seg
  • Identity: null
  • Coverage: null
  • Bit_score: null
30S RIBOSOMAL PROTEIN S16 (db=HMMPanther db_id=PTHR12919 from=11 to=85 evalue=2.5e-12 interpro_id=IPR000307 interpro_description=Ribosomal protein S16 GO=Molecular Function: structural constituent of ribosome (GO:0003735), Cellular Component: intracellular (GO:0005622), Cellular Component: ribosome (GO:0005840), Biological Process: translation (GO:0006412)) iprscan interpro
DB: HMMPanther
  • Identity: null
  • Coverage: null
  • Bit_score: null
  • Evalue 2.50e-12
Ribosomal protein S16 (db=superfamily db_id=SSF54565 from=11 to=61 evalue=2.0e-09 interpro_id=IPR000307 interpro_description=Ribosomal protein S16 GO=Molecular Function: structural constituent of ribosome (GO:0003735), Cellular Component: intracellular (GO:0005622), Cellular Component: ribosome (GO:0005840), Biological Process: translation (GO:0006412)) iprscan interpro
DB: superfamily
  • Identity: null
  • Coverage: null
  • Bit_score: null
  • Evalue 2.00e-09

Lists

This feature is not on any list.

Notes

This feature has no notes.

Taxonomy

uncultured bacterium → Bacteria

Sequences

DNA sequence
Length: 288
ATGCTTCAGGAGAACACGATTGCTCCTGGTGGGCGCCATATCGAAATCCTTGGCAGCTATGATCCTCATTCAAAGGAGGCTGTTTTAAAACAAGATAGAATAAACTATTGGATGTCCAAGGGGGTTCAACTGTCTGATACGGCTTATAATCTTTTTGTCAAAAAAGGCATCATTGAAGGAGGAAAAAGAAAAGTGAAAGTTCCAGCAAAAAAAGTGGAAGAGGTTGCGGCTGAAACTCCAAAAGAAGGAGAAAATGCTGTTGCTGCAGAAGAGGCAAAGGCTGAATAA
PROTEIN sequence
Length: 96
MLQENTIAPGGRHIEILGSYDPHSKEAVLKQDRINYWMSKGVQLSDTAYNLFVKKGIIEGGKRKVKVPAKKVEEVAAETPKEGENAVAAEEAKAE*