ggKbase home page

AMDSBA1_62_12

Organism: S._benefaciens_IM1

near complete RP 52 / 55 MC: 14 BSCG 51 / 51 ASCG 0 / 38
Location: comp(14858..15496)

Top 3 Functional Annotations

Value Algorithm Source
C-terminal effector domain of the bipartite response regulators (db=superfamily db_id=SSF46894 from=121 to=207 evalue=7.4e-20 interpro_id=IPR016032 interpro_description=Signal transduction response regulator, C-terminal effector GO=Molecular Function: two-component response regulator activity (GO:0000156), Biological Process: two-component signal transduction system (phosphorelay) (GO:0000160), Molecular Function: DNA binding (GO:0003677), Cellular Component: intracellular (GO:0005622), Biological Process: iprscan interpro
DB: superfamily
  • Identity: null
  • Coverage: null
  • Bit_score: null
  • Evalue 7.40e-20
no description (db=Gene3D db_id=G3DSA:1.10.10.10 from=116 to=203 evalue=8.1e-17 interpro_id=IPR011991 interpro_description=Winged helix-turn-helix transcription repressor DNA-binding) iprscan interpro
DB: Gene3D
  • Identity: null
  • Coverage: null
  • Bit_score: null
  • Evalue 8.10e-17
no description (db=HMMSmart db_id=SM00421 from=140 to=197 evalue=6.9e-16 interpro_id=IPR000792 interpro_description=Transcription regulator LuxR, C-terminal GO=Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700), Cellular Component: intracellular (GO:0005622), Biological Process: regulation of transcription, DNA-dependent (GO:0006355), Molecular Function: sequence-specific DNA binding (GO:0043565)) iprscan interpro
DB: HMMSmart
  • Identity: null
  • Coverage: null
  • Bit_score: null
  • Evalue 6.90e-16

Lists

This feature is not on any list.

Notes

This feature has no notes.

Taxonomy

Stackebrandtia nassauensis → Stackebrandtia → Glycomycetales → Actinobacteria → Actinobacteria → Bacteria

Sequences

DNA sequence
Length: 639
GTGAACTCAATCGATGTCGGTATTGTCAGTCATTCTCCCATTTTTGCGGCAGGAATACGGGCTGTCCTTGATCGGGATATCGGAGCTCGCGTCATCATTCTGAACTCTCCATCCAGTAATTGGCCCCCCGTCGCGACCGTCATTATTGAATCGGATAACCTGAACCAAATTGAATCGACTTTAATGATTTGCCGTCTCTCCAATCCCGAGGTAAAGTCCGCGGTCTTCCTTTCTCCTTTGACTCTTCATTTGGCCGCTTCGGTCATGAAACTGGGAGTGAACATTCTCCTCGACAAAACCCAGGGATGCGAACAATTGAGCCATTTACTCCGCGCCGTCCTGTCCGCCGAATGCGTCATGGTCAGCCAGTCATTCTGGACAGCGATTCTTCCAGACAATCTCTCCATCAATCACTATTCGATCGGCTTGACGCGACGGGAATTCGAAGTGCTGGCTCTGATCGATCAAAATTATTCCAATACCGAAATTGCCGAGGTTTTACAAATTTCGGTTCACACCGTAAAACGCCACGTCGAGCATCTTTTGCGAAAACTGAACGCGACTGATCGGCACCATTGTGCCCGCATTGCGCATCAAGTGGGAATACTGCATAAAACACGTGCACCTTTGCCAGCATAA
PROTEIN sequence
Length: 213
VNSIDVGIVSHSPIFAAGIRAVLDRDIGARVIILNSPSSNWPPVATVIIESDNLNQIESTLMICRLSNPEVKSAVFLSPLTLHLAASVMKLGVNILLDKTQGCEQLSHLLRAVLSAECVMVSQSFWTAILPDNLSINHYSIGLTRREFEVLALIDQNYSNTEIAEVLQISVHTVKRHVEHLLRKLNATDRHHCARIAHQVGILHKTRAPLPA*