ggKbase home page

AMDSBA5_29_13

Organism: S._thermosulfido._IM5

near complete RP 51 / 55 MC: 14 BSCG 51 / 51 MC: 1 ASCG 0 / 38
Location: comp(9422..9700)

Top 3 Functional Annotations

Value Algorithm Source
no description (db=HMMSmart db_id=SM00421 from=17 to=74 evalue=4.2e-20 interpro_id=IPR000792 interpro_description=Transcription regulator LuxR, C-terminal GO=Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700), Cellular Component: intracellular (GO:0005622), Biological Process: regulation of transcription, DNA-dependent (GO:0006355), Molecular Function: sequence-specific DNA binding (GO:0043565)) iprscan interpro
DB: HMMSmart
  • Identity: null
  • Coverage: null
  • Bit_score: null
  • Evalue 4.20e-20
(db=HMMPfam db_id=PF00196 from=20 to=71 evalue=7.2e-19 interpro_id=IPR000792 interpro_description=Transcription regulator LuxR, C-terminal GO=Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700), Cellular Component: intracellular (GO:0005622), Biological Process: regulation of transcription, DNA-dependent (GO:0006355), Molecular Function: sequence-specific DNA binding (GO:0043565)) iprscan interpro
DB: HMMPfam
  • Identity: null
  • Coverage: null
  • Bit_score: null
  • Evalue 7.20e-19
C-terminal effector domain of the bipartite response regulators (db=superfamily db_id=SSF46894 from=4 to=76 evalue=5.8e-16 interpro_id=IPR016032 interpro_description=Signal transduction response regulator, C-terminal effector GO=Molecular Function: two-component response regulator activity (GO:0000156), Biological Process: two-component signal transduction system (phosphorelay) (GO:0000160), Molecular Function: DNA binding (GO:0003677), Cellular Component: intracellular (GO:0005622), Biological Process: reg iprscan interpro
DB: superfamily
  • Identity: null
  • Coverage: null
  • Bit_score: null
  • Evalue 5.80e-16

Lists

This feature is not on any list.

Notes

This feature has no notes.

Taxonomy

Frankia sp. QA3 → Frankia → Frankiales → Actinobacteria → Actinobacteria → Bacteria

Sequences

DNA sequence
Length: 279
TTGAACCGCGCCCGTCAGATTTATGAGCGACATGATGGGCGCATGAACTCCGTCGGACTGACTGCACGGGAAACGGAAATTCTTGAGCGTGTGGTTCAAGGCCTGACCGACCGCGAGATTGCCCGAGATCTCGTGATTTCTCCCAAGACCGTTGATCGCCATCTGCGCAACATTTTTCGTAAATTAGGAGTTTCTAGTCGGACAGCTTACGCGCGCTGCAAGAAGGATGGCTGTAACCCGTCTTTTATTGTCTTCCAGTGGCCCACCACGATCTTTTGA
PROTEIN sequence
Length: 93
LNRARQIYERHDGRMNSVGLTARETEILERVVQGLTDREIARDLVISPKTVDRHLRNIFRKLGVSSRTAYARCKKDGCNPSFIVFQWPTTIF*