ggKbase home page

AMDSBA5_33_5

Organism: S._thermosulfido._IM5

near complete RP 51 / 55 MC: 14 BSCG 51 / 51 MC: 1 ASCG 0 / 38
Location: 3790..4377

Top 3 Functional Annotations

Value Algorithm Source
SIGMA70_ECF (db=PatternScan db_id=PS01063 from=52 to=84 evalue=0.0 interpro_id=IPR000838 interpro_description=RNA polymerase sigma factor 70, ECF, conserved site GO=Molecular Function: DNA binding (GO:0003677), Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700), Biological Process: transcription initiation, DNA-dependent (GO:0006352), Biological Process: regulation of transcription, DNA-dependent (GO:0006355), Molecular Function: sigma factor activity (GO:0016987)) iprscan interpro
DB: PatternScan
  • Identity: null
  • Coverage: null
  • Bit_score: null
  • Evalue 0.0
sigma70-ECF: RNA polymerase sigma factor, (db=HMMTigr db_id=TIGR02937 from=25 to=180 evalue=6.0e-39 interpro_id=IPR014284 interpro_description=RNA polymerase sigma-70 GO=Molecular Function: DNA binding (GO:0003677), Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700), Biological Process: transcription initiation, DNA-dependent (GO:0006352), Biological Process: regulation of transcription, DNA-dependent (GO:0006355), Molecular Function: sigma factor activity (GO:00169 iprscan interpro
DB: HMMTigr
  • Identity: null
  • Coverage: null
  • Bit_score: null
  • Evalue 6.00e-39
Sigma2 domain of RNA polymerase sigma factors (db=superfamily db_id=SSF88946 from=4 to=117 evalue=2.4e-22 interpro_id=IPR013325 interpro_description=RNA polymerase sigma factor, region 2 GO=Molecular Function: DNA binding (GO:0003677), Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700), Biological Process: transcription initiation, DNA-dependent (GO:0006352), Biological Process: regulation of transcription, DNA-dependent (GO:0006355), Molecular Function: sigma facto iprscan interpro
DB: superfamily
  • Identity: null
  • Coverage: null
  • Bit_score: null
  • Evalue 2.40e-22

Lists

This feature is not on any list.

Notes

This feature has no notes.

Taxonomy

Pandoraea pnomenusa → Pandoraea → Burkholderiales → Betaproteobacteria → Proteobacteria → Bacteria

Sequences

DNA sequence
Length: 588
ATGGGCTATTCGGATGACGTGGATCATTGCTCCGATGAAGAACTGATAATTCGTATCCAACGGCGCGACGATAAGGCATTTGAGCAACTCTACAACCGGTATGCGTCACGGGTCCTTGGATTAATTCGGCGTGTAATTTTTGATACAAATGAATCCGAAGATGTGTTACAGATCGTATTTATGAGTATATGGCAGAAGTGTCATCAATACGAGCGAGAGCGGGGAAGTGTTCAAGCTTTTATCTTCCAAATTGCGAAAACCCGGATGATTGATTACATGCGTAGCCACCGTCATCATGATGACGTGTTAGTGGATATGGAAGAAGAAGATCGCCAGCCTGATCCCATTGAACTGGATCAGGTGAGTCATGTGGTGGTCGATGATTTGTTGAAGGCTTTAAGCGCCGATGAAAGACGCGCATTAGAACTGACCGTTTATGGGGGCTTTACCCAACAAGAAATCGCCAAATTGTTGCACAAGCCACCAGGTACCGTGAAAAGCTGGATTCGACGGGGACTCATCAAACTTAAACGGATCGTTTCAGAAACGGCTAATGAAGGAGGGGAGGGAGAAAAATGGCACATCTAA
PROTEIN sequence
Length: 196
MGYSDDVDHCSDEELIIRIQRRDDKAFEQLYNRYASRVLGLIRRVIFDTNESEDVLQIVFMSIWQKCHQYERERGSVQAFIFQIAKTRMIDYMRSHRHHDDVLVDMEEEDRQPDPIELDQVSHVVVDDLLKALSADERRALELTVYGGFTQQEIAKLLHKPPGTVKSWIRRGLIKLKRIVSETANEGGEGEKWHI*