ggKbase home page

AMDSBA5_158_1

Organism: S._thermosulfido._IM5

near complete RP 51 / 55 MC: 14 BSCG 51 / 51 MC: 1 ASCG 0 / 38
Location: 1..360

Top 3 Functional Annotations

Value Algorithm Source
C-terminal effector domain of the bipartite response regulators (db=superfamily db_id=SSF46894 from=5 to=102 evalue=9.1e-19 interpro_id=IPR016032 interpro_description=Signal transduction response regulator, C-terminal effector GO=Molecular Function: two-component response regulator activity (GO:0000156), Biological Process: two-component signal transduction system (phosphorelay) (GO:0000160), Molecular Function: DNA binding (GO:0003677), Cellular Component: intracellular (GO:0005622), Biological Process: re iprscan interpro
DB: superfamily
  • Identity: null
  • Coverage: null
  • Bit_score: null
  • Evalue 9.10e-19
no description (db=Gene3D db_id=G3DSA:1.10.10.10 from=4 to=100 evalue=5.8e-15 interpro_id=IPR011991 interpro_description=Winged helix-turn-helix transcription repressor DNA-binding) iprscan interpro
DB: Gene3D
  • Identity: null
  • Coverage: null
  • Bit_score: null
  • Evalue 5.80e-15
(db=HMMPfam db_id=PF00486 from=26 to=99 evalue=3.4e-13 interpro_id=IPR001867 interpro_description=Signal transduction response regulator, C-terminal GO=Molecular Function: two-component response regulator activity (GO:0000156), Biological Process: two-component signal transduction system (phosphorelay) (GO:0000160), Molecular Function: DNA binding (GO:0003677), Biological Process: regulation of transcription, DNA-dependent (GO:0006355)) iprscan interpro
DB: HMMPfam
  • Identity: null
  • Coverage: null
  • Bit_score: null
  • Evalue 3.40e-13

Lists

This feature is not on any list.

Notes

This feature has no notes.

Taxonomy

Microcystis aeruginosa → Microcystis → Chroococcales → Oscillatoriophycideae → Cyanobacteria → Bacteria

Sequences

DNA sequence
Length: 360
GCACCTATCGACAGCATTTGGATTGATGACGAGATTCTATTAGATTGCGCGCAACAAGGAATTTGGCGACACAATCAGTTTGTCCCATTAACAGCCCGAGCGTATCGCTTTTTATTATATTTCGTTCATCATCCTCGCCAGATTATCCCGATACCTCAGTTACTTCACATCGGTTGGCCGGATGAAATGCGCACCCCTCGGGATCTTTATGGTCATATCTATCGATTGCGTCGGGTTATCGAATCCGATCCTCGGCATCCCCGCTTATTAGTCACGCGTCGGGATGCGGGCTACTTATGGACAGCCATTCCCCATAACCAAATGGACTCCCGCCGAGTCTCACAGATAATCTCAACCTAA
PROTEIN sequence
Length: 120
APIDSIWIDDEILLDCAQQGIWRHNQFVPLTARAYRFLLYFVHHPRQIIPIPQLLHIGWPDEMRTPRDLYGHIYRLRRVIESDPRHPRLLVTRRDAGYLWTAIPHNQMDSRRVSQIIST*