ggKbase home page

AMDSBA2_54_16

Organism: S._sp._IM6

near complete RP 49 / 55 MC: 13 BSCG 51 / 51 MC: 1 ASCG 0 / 38
Location: comp(9188..9448)

Top 3 Functional Annotations

Value Algorithm Source
Sigma3 and sigma4 domains of RNA polymerase sigma factors (db=superfamily db_id=SSF88659 from=7 to=67 evalue=1.9e-08 interpro_id=IPR013324 interpro_description=RNA polymerase sigma factor, region 3/4 GO=Molecular Function: DNA binding (GO:0003677), Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700), Biological Process: transcription initiation, DNA-dependent (GO:0006352), Biological Process: regulation of transcription, DNA-dependent (GO:0006355), Molecular Function iprscan interpro
DB: superfamily
  • Identity: 0.0
  • Coverage: 0.0
  • Bit_score: 0
  • Evalue 1.00e+00
no description (db=Gene3D db_id=G3DSA:1.10.10.10 from=8 to=80 evalue=1.2e-06 interpro_id=IPR011991 interpro_description=Winged helix-turn-helix transcription repressor DNA-binding) iprscan interpro
DB: Gene3D
  • Identity: 0.0
  • Coverage: 0.0
  • Bit_score: 0
  • Evalue 1.00e+00
(db=HMMPfam db_id=PF04545 from=14 to=66 evalue=4.7e-07 interpro_id=IPR007630 interpro_description=RNA polymerase sigma-70 region 4 GO=Molecular Function: DNA binding (GO:0003677), Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700), Biological Process: transcription initiation, DNA-dependent (GO:0006352), Biological Process: regulation of transcription, DNA-dependent (GO:0006355), Molecular Function: sigma factor activity (GO:0016987)) iprscan interpro
DB: HMMPfam
  • Identity: 0.0
  • Coverage: 0.0
  • Bit_score: 0
  • Evalue 4.00e+00

Lists

This feature is not on any list.

Notes

This feature has no notes.

Taxonomy

Sequences

DNA sequence
Length: 261
ATGTCCATTTCTCCCGCTGTGCGTCGGGCCATTACCCAAGCGTTACACACCTTACCGTCTGAGGTTTTTCCGGTCATCAGTTTATCGTTTGGGTTTCTCGATGGGAATCCGTATTCTGTCCGCCAAGTGGCCCGGACGCTGCATCTCTCGGAACGCCGCGTCAAGCAACTGCTCCAGTCCGGCCTTACCACGCTCCAAGCGGATCCGGTCCTGTATCAGCACTTTCGTCTCTTACAAACCCAAGCCATTTTGCGCCATTAA
PROTEIN sequence
Length: 87
MSISPAVRRAITQALHTLPSEVFPVISLSFGFLDGNPYSVRQVARTLHLSERRVKQLLQSGLTTLQADPVLYQHFRLLQTQAILRH*