ggKbase home page

13_1_40cm_scaffold_22_6

Organism: 13_1_40CM_Rokubacteria_69_27

near complete RP 48 / 55 MC: 3 BSCG 46 / 51 ASCG 14 / 38
Location: comp(5547..5822)

Top 3 Functional Annotations

Value Algorithm Source
resA; thiol-disulfide oxidoreductase resA Tax=RIFCSPHIGHO2_02_FULL_Rokubacteria_69_13_curated similarity UNIPROT
DB: UniProtKB
  • Identity: 59.1
  • Coverage: 88.0
  • Bit_score: 108
  • Evalue 4.20e-21
putative thiol-disulfide oxidoreductase id=14627055 bin=bin7_NC10_sister species=unknown genus=unknown taxon_order=Burkholderiales taxon_class=Betaproteobacteria phylum=Proteobacteria tax=bin7_NC10_sister organism_group=NC10 similarity UNIREF
DB: UNIREF100
  • Identity: 51.1
  • Coverage: 88.0
  • Bit_score: 99
  • Evalue 1.80e-18

Lists

This feature is not on any list.

Notes

TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins. TlpA, ResA and DsbE are bacterial protein disulfide reductases with important roles in cytochrome maturation. They are membrane-anchored proteins with a soluble TRX domain containing a CXXC motif located in the periplasm. The TRX domains of this family contain an insert, approximately 25 residues in length, which correspond to an extra alpha helix and a beta strand when compared with TRX. TlpA catalyzes an essential reaction in the biogenesis of cytochrome aa3, while ResA and DsbE are essential proteins in cytochrome c maturation. Also included in this family are proteins containing a TlpA-like TRX domain with domain architectures similar to E. coli DipZ protein, and the N-terminal TRX domain of PilB protein from Neisseria which acts as a disulfide reductase that can recylce methionine sulfoxide reductases. Cristina Butterfield (8/24/16)
Maybe SoxW. SoxW is a periplasmic thioredoxin, which takes part in electron transport process Cristina Butterfield (6/2/15)

Taxonomy

R_Rokubacteria_69_13 → Rokubacteria → Bacteria

Sequences

DNA sequence
Length: 276
GTGCACCGGGAGTTCAAGGACAAGGGGCTGGCCGTGGTCGCCATCAGCATCCAGGAGCCGCCTGACAGGGTCGCCGCCTGGGTCAAGACCCACAACACGTCCTTCACCGTTCTGCTCGATGCCGACGGCAGCGTCACCCGACAGTATGAGGTCACCGCGACCCCCACCGTGTTCATCGTCGGTCGGGACGGTACGCTGCTCGGCAAGGCGCTCGGCACCAAGGCCTGGACCTCCGACACGGGCCGCGCCCTGCTCCAGGCCCTCGCGGGTTCGTGA
PROTEIN sequence
Length: 92
VHREFKDKGLAVVAISIQEPPDRVAAWVKTHNTSFTVLLDADGSVTRQYEVTATPTVFIVGRDGTLLGKALGTKAWTSDTGRALLQALAGS*