ggKbase home page

ACD5_158_1

Organism: ACD5

megabin RP 49 / 55 MC: 26 BSCG 49 / 51 MC: 19 ASCG 0 / 38
Location: comp(3..116)

Top 3 Functional Annotations

Value Algorithm Source
50S RIBOSOMAL PROTEIN L2 (db=HMMPanther db_id=PTHR13691:SF5 from=1 to=38 evalue=4.9e-13 interpro_id=IPR005880 interpro_description=Ribosomal protein L2, bacterial-type GO=Molecular Function: RNA binding (GO:0003723), Molecular Function: structural constituent of ribosome (GO:0003735), Biological Process: translation (GO:0006412), Cellular Component: large ribosomal subunit (GO:0015934), Molecular Function: transferase activity (GO:0016740)) iprscan interpro
DB: HMMPanther
  • Identity: null
  • Coverage: null
  • Bit_score: null
  • Evalue 4.90e-13
RIBOSOMAL PROTEIN L2 (db=HMMPanther db_id=PTHR13691 from=1 to=38 evalue=4.9e-13 interpro_id=IPR002171 interpro_description=Ribosomal protein L2 GO=Molecular Function: structural constituent of ribosome (GO:0003735), Cellular Component: intracellular (GO:0005622), Cellular Component: ribosome (GO:0005840), Biological Process: translation (GO:0006412)) iprscan interpro
DB: HMMPanther
  • Identity: null
  • Coverage: null
  • Bit_score: null
  • Evalue 4.90e-13
Ribosomal_L2_C (db=HMMPfam db_id=PF03947 from=1 to=38 evalue=2.4e-11 interpro_id=IPR022669 interpro_description=Ribosomal protein L2, C-terminal GO=Molecular Function: structural constituent of ribosome (GO:0003735), Cellular Component: intracellular (GO:0005622), Cellular Component: ribosome (GO:0005840), Biological Process: translation (GO:0006412)) iprscan interpro
DB: HMMPfam
  • Identity: null
  • Coverage: null
  • Bit_score: null
  • Evalue 2.40e-11

Lists

This feature is not on any list.

Notes

This feature has no notes.

Taxonomy

GWC1_OD1_38_22 → Parcubacteria → Bacteria

Sequences

DNA sequence
Length: 114
ATGTCATCTGGTGAAATCAGATTGGTAAGCAAAGAATGCTACGCATCTATCGGACGAGTAAGTAATTTCGAACATAGTGCTGAAACTCTTGGAAAGGCTGGAAGAAATCGTTGG
PROTEIN sequence
Length: 38
MSSGEIRLVSKECYASIGRVSNFEHSAETLGKAGRNRW