ggKbase home page

AMDSBA1_57_17

Organism: S._benefaciens_IM1

near complete RP 52 / 55 MC: 14 BSCG 51 / 51 ASCG 0 / 38
Location: comp(18467..19036)

Top 3 Functional Annotations

Value Algorithm Source
sigma70-ECF: RNA polymerase sigma factor, (db=HMMTigr db_id=TIGR02937 from=18 to=177 evalue=2.6e-27 interpro_id=IPR014284 interpro_description=RNA polymerase sigma-70 GO=Molecular Function: DNA binding (GO:0003677), Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700), Biological Process: transcription initiation, DNA-dependent (GO:0006352), Biological Process: regulation of transcription, DNA-dependent (GO:0006355), Molecular Function: sigma factor activity (GO:00169 iprscan interpro
DB: HMMTigr
  • Identity: null
  • Coverage: null
  • Bit_score: null
  • Evalue 2.60e-27
Sigma2 domain of RNA polymerase sigma factors (db=superfamily db_id=SSF88946 from=3 to=113 evalue=1.8e-11 interpro_id=IPR013325 interpro_description=RNA polymerase sigma factor, region 2 GO=Molecular Function: DNA binding (GO:0003677), Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700), Biological Process: transcription initiation, DNA-dependent (GO:0006352), Biological Process: regulation of transcription, DNA-dependent (GO:0006355), Molecular Function: sigma facto iprscan interpro
DB: superfamily
  • Identity: null
  • Coverage: null
  • Bit_score: null
  • Evalue 1.80e-11
Sigma3 and sigma4 domains of RNA polymerase sigma factors (db=superfamily db_id=SSF88659 from=109 to=179 evalue=2.0e-11 interpro_id=IPR013324 interpro_description=RNA polymerase sigma factor, region 3/4 GO=Molecular Function: DNA binding (GO:0003677), Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700), Biological Process: transcription initiation, DNA-dependent (GO:0006352), Biological Process: regulation of transcription, DNA-dependent (GO:0006355), Molecular Funct iprscan interpro
DB: superfamily
  • Identity: null
  • Coverage: null
  • Bit_score: null
  • Evalue 2.00e-11

Lists

This feature is not on any list.

Notes

This feature has no notes.

Taxonomy

Brevibacillus borstelensis → Brevibacillus → Bacillales → Bacilli → Firmicutes → Bacteria

Sequences

DNA sequence
Length: 570
GTGCCGATTACCCGGGAGAACGTGATATGGCAATTGCGGGAACGCCCCGCTGAAGCCCTTTCTTTTCTTATTCACGATCACGCAGACGCCATCGCATCGCTAGTGTCTCGCATCCTAGCGGGCGTTGGGACACCCGAAGACGTGGAGGAGTGCGTAAGCGAGGTGTTCATTCAGGCTTGGCACCGCGCCCAAGAATATGATGAGAGGCGAGGCACAGTACGCACCTGGCTTCTCATACTCGCCAAGTACCAGGCATTAACTCTTCGCCGCCGCTTGGTGCAGCACAAGGACCTTGAGTCCGAAAGCGTCGATCAAAGATCGGATCCGGTGCTGTCGCAGGTACTTTCCCGCGAGCGCCAGGAATCCTTGGTGTCGTGTATCCAACGTCTCGAACCGGGCGTCCGGGACGTGATCATTTACCGTTACTTCTTGGATATGGCGATCCCGCTTATCGCCACCAAACTTCAATTGACGCGAAGCCAAGTTTATAATCGGCTATCACGTGGTCGAGAGCAGCTGCGGCAACAGTGGGACGGCATGAACATTGATGGAGGGGGAACCCTGAAGTGA
PROTEIN sequence
Length: 190
VPITRENVIWQLRERPAEALSFLIHDHADAIASLVSRILAGVGTPEDVEECVSEVFIQAWHRAQEYDERRGTVRTWLLILAKYQALTLRRRLVQHKDLESESVDQRSDPVLSQVLSRERQESLVSCIQRLEPGVRDVIIYRYFLDMAIPLIATKLQLTRSQVYNRLSRGREQLRQQWDGMNIDGGGTLK*