ggKbase home page

MEL_C3_40_14

Organism: MEL.C3

partial RP 36 / 55 MC: 3 BSCG 39 / 51 ASCG 0 / 38
Location: 9320..9877

Top 3 Functional Annotations

Value Algorithm Source
Sigma3 and sigma4 domains of RNA polymerase sigma factors (db=superfamily db_id=SSF88659 from=108 to=178 evalue=3.1e-12 interpro_id=IPR013324 interpro_description=RNA polymerase sigma factor, region 3/4 GO=Molecular Function: DNA binding (GO:0003677), Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700), Biological Process: transcription initiation, DNA-dependent (GO:0006352), Biological Process: regulation of transcription, DNA-dependent (GO:0006355), Molecular Funct iprscan interpro
DB: superfamily
  • Identity: null
  • Coverage: null
  • Bit_score: null
  • Evalue 3.10e-12
(db=HMMPfam db_id=PF04545 from=125 to=172 evalue=7.5e-12 interpro_id=IPR007630 interpro_description=RNA polymerase sigma-70 region 4 GO=Molecular Function: DNA binding (GO:0003677), Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700), Biological Process: transcription initiation, DNA-dependent (GO:0006352), Biological Process: regulation of transcription, DNA-dependent (GO:0006355), Molecular Function: sigma factor activity (GO:0016987)) iprscan interpro
DB: HMMPfam
  • Identity: null
  • Coverage: null
  • Bit_score: null
  • Evalue 7.50e-12
Sigma3 and sigma4 domains of RNA polymerase sigma factors (db=superfamily db_id=SSF88659 from=30 to=106 evalue=2.3e-07 interpro_id=IPR013324 interpro_description=RNA polymerase sigma factor, region 3/4 GO=Molecular Function: DNA binding (GO:0003677), Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700), Biological Process: transcription initiation, DNA-dependent (GO:0006352), Biological Process: regulation of transcription, DNA-dependent (GO:0006355), Molecular Functi iprscan interpro
DB: superfamily
  • Identity: null
  • Coverage: null
  • Bit_score: null
  • Evalue 2.30e-07

Lists

This feature is not on any list.

Notes

This feature has no notes.

Taxonomy

Clostridium sp. CAG:306 → Melainabacteria → Bacteria

Sequences

DNA sequence
Length: 558
GTGAGCAACAAATTTAAAACATATGCTACATATAAAATTACAGGTGAAATAAAACACTACCTTCGCGATAAGATAGCAATGATTAGACCATCACGTGCAATCCAGGAGCTTGCTTATCGTATTTCACAAATAAGAGCAAGTTTAATTGCTAATAATATTGAAAACCCGACTGATTACGATATAGCAAAAGTTCTTCAAATGCCAATTGAAAAAATTAATGATGTTATGGAGTATGACCGGAGAAAAAACGTTATTTCTCTTGAACAGATATCACTTGATAATGAATATACAATATCAGAGAATATACTTATTAATCACGATGAACTAATTGATTTTAAATCCATAAACGAAAACAAACTTGAAGTTAAGGACGCTATATCACAACTTGATAAACAGCTTCAAGATATAGTAAAACTTACTTTTTTTGAAGGTTATTCGCAAAGAGAAATTGGATCATTACTAAATATAAATCAAATGATGGTTTCACGCCTATTAAAAAAGGCATTAAAACAACTATTTCAAATATTAAGTGAGAAAAATGATGATAACTCAAATTAA
PROTEIN sequence
Length: 186
VSNKFKTYATYKITGEIKHYLRDKIAMIRPSRAIQELAYRISQIRASLIANNIENPTDYDIAKVLQMPIEKINDVMEYDRRKNVISLEQISLDNEYTISENILINHDELIDFKSINENKLEVKDAISQLDKQLQDIVKLTFFEGYSQREIGSLLNINQMMVSRLLKKALKQLFQILSEKNDDNSN*