ggKbase home page

ACD24_36_5

Organism: ACD24

partial RP 42 / 55 MC: 13 BSCG 35 / 51 MC: 9 ASCG 0 / 38
Location: comp(3478..3711)

Top 3 Functional Annotations

Value Algorithm Source
SIGMA70_2 (db=PatternScan db_id=PS00716 from=36 to=62 evalue=0.0 interpro_id=IPR000943 interpro_description=RNA polymerase sigma-70 factor GO=Molecular Function: DNA binding (GO:0003677), Molecular Function: transcription factor activity (GO:0003700), Biological Process: transcription initiation (GO:0006352), Biological Process: regulation of transcription, DNA-dependent (GO:0006355), Molecular Function: sigma factor activity (GO:0016987)) iprscan interpro
DB: PatternScan
  • Identity: null
  • Coverage: null
  • Bit_score: null
  • Evalue 0.0
Sigma70_r4 (db=HMMPfam db_id=PF04545 from=20 to=63 evalue=2.3e-13 interpro_id=IPR007630 interpro_description=RNA polymerase sigma-70 region 4 GO=Molecular Function: DNA binding (GO:0003677), Molecular Function: transcription factor activity (GO:0003700), Biological Process: transcription initiation (GO:0006352), Biological Process: regulation of transcription, DNA-dependent (GO:0006355), Molecular Function: sigma factor activity (GO:0016987)) iprscan interpro
DB: HMMPfam
  • Identity: null
  • Coverage: null
  • Bit_score: null
  • Evalue 2.30e-13
Sigma3 and sigma4 domains of RNA polymerase sigma factors (db=superfamily db_id=SSF88659 from=2 to=68 evalue=1.3e-10 interpro_id=IPR013324 interpro_description=RNA polymerase sigma factor, region 3/4 GO=Molecular Function: DNA binding (GO:0003677), Molecular Function: transcription factor activity (GO:0003700), Biological Process: transcription initiation (GO:0006352), Biological Process: regulation of transcription, DNA-dependent (GO:0006355), Molecular Function: sigma factor activity (GO:0016987)) iprscan interpro
DB: superfamily
  • Identity: null
  • Coverage: null
  • Bit_score: null
  • Evalue 1.30e-10

Lists

This feature is not on any list.

Notes

This feature has no notes.

Taxonomy

uncultured bacterium → Bacteria

Sequences

DNA sequence
Length: 234
ATGCGCTCCAACCAAACAACGCTTTATTTTAAATCGTTAATTAAACACAATTTTGATCTTAGCGGAAAAGAAAGTGAAGTATTAATTAAACGTCTGCGAAGAACTACATTAGAAGAAATAGGTAAGAAATTTGGAATAACCGAATCGAGAGTCCGTCAAATCGAAAGGACAGCGCTTTCAAAAATAAAAAGTAAAACTCACCAGCTCGCGCTTTTCAAGATTCGCCAGAAGTAA
PROTEIN sequence
Length: 78
MRSNQTTLYFKSLIKHNFDLSGKESEVLIKRLRRTTLEEIGKKFGITESRVRQIERTALSKIKSKTHQLALFKIRQK*